Structure of PDB 2rfb Chain B

Receptor sequence

>2rfbB (length=335)

MRLNDPVHYDGAWHVYKYSDVKHVLMNDKIFSSNGGISFITMDNPEHKEF
RDISAPYFLPSKINDYKDFIEETSNDLIKNIDNKDIISEYAVRLPVNIIS
KILGIPDSDMPLFKLWSDYIIGNKRDENFNYVNNRMVSRLLEIFKSDSHG
IINVLAGSSLKNRKLTMDEKIKYIMLLIIGGNETTTNLIGNMIRVIDENP
DIIDDALKNRSGFVEETLRYYSPIQFLPHRFAAEDSYINNKKIKKGDQVI
VYLGSANRDETFFDEPDLFKIGRREMHLAFGIGIHMCLGAPLARLEASIA
LNDILNHFKRIKIDYKKSRLLDNKMVLGYDKLFLS

3D structure

• PDB: 2rfb Crystal Structure and Properties of CYP231A2 from the Thermoacidophilic Archaeon Picrophilus torridus.
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G139 G197 E200 T201 T202 I241 C304 L305 G306 E313 V343
• Catalytic site (residue number reindexed from 1): G122 G180 E183 T184 T185 I224 C287 L288 G289 E296 V326
• Enzyme Commision number: 1.14.14.1: unspecific monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F56 I57 H64 R68 L193 L194 G197 G198 T201 R247 A296 F297 H302 C304 G306	F39 I40 H47 R51 L176 L177 G180 G181 T184 R230 A279 F280 H285 C287 G289

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

External links

• PDB: RCSB:2rfb, PDBe:2rfb, PDBj:2rfb
• PDBsum: 2rfb
• PubMed: 18197710
• UniProt: Q6KZ68