Structure of PDB 2r80 Chain B

Receptor sequence
>2r80B (length=146) Species: 8932 (Columba livia) [Search protein sequence]
VHWSAEEKQLITSIWGKVNVADCGAEALARLLIVYPWTQRFFSSFGNLSS
ATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDP
ENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKYH
3D structure
PDB2r80 X-ray crystal structure analysis of Hemolgobin from Pigeon (Columba Livia) at 1.44 angstrom
ChainB
Resolution1.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM B T38 F41 F42 H63 S70 L88 L91 H92 L96 V98 N102 F103 L106 L141 T38 F41 F42 H63 S70 L88 L91 H92 L96 V98 N102 F103 L106 L141
BS02 OXY B H63 V67 H63 V67
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2r80, PDBe:2r80, PDBj:2r80
PDBsum2r80
PubMed
UniProtP11342|HBB_COLLI Hemoglobin subunit beta (Gene Name=HBB)

[Back to BioLiP]