Structure of PDB 2r5y Chain B

Receptor sequence
>2r5yB (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN
KRIRYKKNI
3D structure
PDB2r5y Functional specificity of a Hox protein mediated by the recognition of minor groove structure
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R205 F208 Q244 N247 N251 R255 R1 F4 Q43 N46 N50 R54 PDBbind-CN: Kd=10.3nM
BS02 dna B R205 R206 Y225 R253 I254 K257 R1 R2 Y24 R52 I53 K56 PDBbind-CN: Kd=10.3nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2r5y, PDBe:2r5y, PDBj:2r5y
PDBsum2r5y
PubMed17981120
UniProtP40427|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]