Structure of PDB 2r45 Chain B

Receptor sequence

>2r45B (length=495) Species: 562 (Escherichia coli)

METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIH
GGLRYLEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWM
IRIGLFMYDHLGKRTSLPGSTGLRFGANSVLKPEIKRGFEYSDCWVDDAR
LVLANAQMVVRKGGEVLTRTRATSARRENGLWIVEAEDIDTGKKYSWQAR
GLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVHTQKQAYILQN
EDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLNVYNTHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSV
FGGKLTTYRKLAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAA
RLRRRYPFLTESLARHYARTYGSNSELLLGNAGTVSDLGEDFGHEFYEAE
LKYLVDHEWVRRADDALWRRTKQGMWLNADQQSRVSQWLVEYTQQ

3D structure

• PDB: 2r45 Structure of glycerol-3-phosphate dehydrogenase, an essential monotopic membrane enzyme involved in respiration and metabolism
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 1.1.5.3: glycerol-3-phosphate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PO4	B	Y398 R401 R405	Y398 R401 R405
BS02	PO4	B	P208 Q212 P279	P208 Q212 P279
BS03	FAD	B	I9 G12 I13 N14 E33 A34 C39 T41 S42 S45 S46 L48 A172 T206 W209 G231 R317 G353 K354 L355 T356	I9 G12 I13 N14 E33 A34 C39 T41 S42 S45 S46 L48 A172 T206 W209 G231 R317 G353 K354 L355 T356
BS04	T3A	B	Q157 V455 D456 H457 W459	Q157 V455 D456 H457 W459
BS05	2PG	B	R54 Y55 R254 I255 T270 R317 R332	R54 Y55 R254 I255 T270 R317 R332

Gene Ontology

Molecular Function

• GO:0004368 glycerol-3-phosphate dehydrogenase (quinone) activity
• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0042803 protein homodimerization activity
• GO:0071949 FAD binding

Biological Process

• GO:0006071 glycerol metabolic process
• GO:0006072 glycerol-3-phosphate metabolic process
• GO:0006796 phosphate-containing compound metabolic process
• GO:0009060 aerobic respiration
• GO:0009061 anaerobic respiration
• GO:0019563 glycerol catabolic process
• GO:0019637 organophosphate metabolic process
• GO:0046168 glycerol-3-phosphate catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0009331 glycerol-3-phosphate dehydrogenase (FAD) complex

External links

• PDB: RCSB:2r45, PDBe:2r45, PDBj:2r45
• PDBsum: 2r45
• PubMed: 18296637
• UniProt: P13035|GLPD_ECOLI Aerobic glycerol-3-phosphate dehydrogenase (Gene Name=glpD)