Structure of PDB 2r1h Chain B

Receptor sequence

>2r1hB (length=147) Species: 8022 (Oncorhynchus mykiss)

VDWTDAERSAIVGLWGKISVDEIGPQALARLLIVSPWTQRHFSTFGNLST
PAAIMGNPAVAKHGKTVMHGLDRAVQNLDDIKNTYVTLSVMHSEKLFVDP
DNFRLLADCITVCVAAKLGPAVFSADTQEAFQKFLAVVVSALGRQYH

3D structure

• PDB: 2r1h Structural analysis of fish versus mammalian hemoglobins: Effect of the heme pocket environment on autooxidation and hemin loss.
• Chain: B
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	H41 F42 F45 H63 M91 H92 L96 V98 N102 F103 L106 L142	H41 F42 F45 H63 M91 H92 L96 V98 N102 F103 L106 L142

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:2r1h, PDBe:2r1h, PDBj:2r1h
• PDBsum: 2r1h
• PubMed: 18831041
• UniProt: P02141|HBB4_ONCMY Hemoglobin subunit beta-4 (Gene Name=hbb4)