Structure of PDB 2qx1 Chain B

Receptor sequence

>2qx1B (length=334) Species: 1773 (Mycobacterium tuberculosis)

MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTRTGIK
TRRFAADDESAASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPA
APMVAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTE
KLSPTIDMYDRGNCFIFADGAAAVVVGETPFQGIGPTVAGSDGEQADAIR
QDIDWITFAQNPSGPRPFVRLEGPAVFRWAAFKMGDVGRRAMDAAGVRPD
QIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAASIPLAMA
ELLTTGAAKPGDLALLIGYGAGLSYAAQVVRMPK

3D structure

• PDB: 2qx1 Probing reactivity and substrate specificity of both subunits of the dimeric Mycobacterium tuberculosis FabH using alkyl-CoA disulfide inhibitors and acyl-CoA substrates
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.301: mycobacterial beta-ketoacyl-[acyl carrier protein] synthase III.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	D1T	B	Q86 T87	Q96 T97
BS02	D1T	B	C112 L142 T145 I189 Q191 V205 S276 G305 A306	C122 L152 T155 I199 Q201 V219 S291 G320 A321

Gene Ontology

Molecular Function

• GO:0000062 fatty-acyl-CoA binding
• GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity
• GO:0005515 protein binding
• GO:0016746 acyltransferase activity
• GO:0033818 beta-ketoacyl-acyl-carrier-protein synthase III activity
• GO:0061990 beta-ketodecanoyl-[acyl-carrier-protein] synthase activity

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0030497 fatty acid elongation
• GO:0035336 long-chain fatty-acyl-CoA metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2qx1, PDBe:2qx1, PDBj:2qx1
• PDBsum: 2qx1
• PubMed: 18096200
• UniProt: P9WNG3|FABH_MYCTU Mycobacterial beta-ketoacyl-[acyl-carrier-protein] synthase III (Gene Name=fabH)