Structure of PDB 2qsp Chain B

Receptor sequence

>2qspB (length=145) Species: 9913 (Bos taurus)

MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTA
DAVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPE
NFKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH

3D structure

• PDB: 2qsp Structural analysis of fish versus mammalian hemoglobins: Effect of the heme pocket environment on autooxidation and hemin loss.
• Chain: B
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	T37 F40 F41 H62 S69 F70 L90 H91 L95 V97 N101 F102 L105 L140	T37 F40 F41 H62 S69 F70 L90 H91 L95 V97 N101 F102 L105 L140

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:2qsp, PDBe:2qsp, PDBj:2qsp
• PDBsum: 2qsp
• PubMed: 18831041
• UniProt: P02070|HBB_BOVIN Hemoglobin subunit beta (Gene Name=HBB)