Structure of PDB 2qo0 Chain B

Receptor sequence

>2qo0B (length=331) Species: 1773 (Mycobacterium tuberculosis)

MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDEWIYTRTGIKTRR
FAADDESAASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPM
VAASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLS
PTIDMYDRGNCFIFADGAAAVVVGETPFQGIGPTVAGSDGEQADAIRQDI
DWITFAQNPSGPRPFVRLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQID
VFVPHQFNSRINELLVKNLQLRPDAVVANDIEHTGNTSAASIPLAMAELL
TTGAAKPGDLALLIGYGAGLSYAAQVVRMPK

3D structure

• PDB: 2qo0 Separate Entrance and Exit Portals for Ligand Traffic in Mycobacterium tuberculosis FabH
• Chain: B
• Resolution: 1.85 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.301: mycobacterial beta-ketoacyl-[acyl carrier protein] synthase III.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	D1T	B	N81 C112 L142 T145 Q191 P203 V205 A306	N88 C119 L149 T152 Q198 P214 V216 A318

Gene Ontology

Molecular Function

• GO:0000062 fatty-acyl-CoA binding
• GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity
• GO:0005515 protein binding
• GO:0016746 acyltransferase activity
• GO:0033818 beta-ketoacyl-acyl-carrier-protein synthase III activity
• GO:0061990 beta-ketodecanoyl-[acyl-carrier-protein] synthase activity

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0030497 fatty acid elongation
• GO:0035336 long-chain fatty-acyl-CoA metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2qo0, PDBe:2qo0, PDBj:2qo0
• PDBsum: 2qo0
• PubMed: 18420147
• UniProt: P9WNG3|FABH_MYCTU Mycobacterial beta-ketoacyl-[acyl-carrier-protein] synthase III (Gene Name=fabH)