Structure of PDB 2qfi Chain B

Receptor sequence

>2qfiB (length=286) Species: 562 (Escherichia coli)

YGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASL
TNLLVVRYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQH
LISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHY
QSDVMMNGAILLALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQS
LLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSGPTRFIQIHLEMEDS
LPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVV

3D structure

• PDB: 2qfi Structure of the zinc transporter YiiP.
• Chain: B
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	H283 D285	H279 D281

Gene Ontology

Molecular Function

• GO:0005381 iron ion transmembrane transporter activity
• GO:0005385 zinc ion transmembrane transporter activity
• GO:0008324 monoatomic cation transmembrane transporter activity
• GO:0015086 cadmium ion transmembrane transporter activity
• GO:0015093 ferrous iron transmembrane transporter activity
• GO:0015297 antiporter activity
• GO:0015341 zinc efflux active transmembrane transporter activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding
• GO:0046873 metal ion transmembrane transporter activity
• GO:0140826 zinc:proton antiporter activity

Biological Process

• GO:0006812 monoatomic cation transport
• GO:0006826 iron ion transport
• GO:0006829 zinc ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006882 intracellular zinc ion homeostasis
• GO:0034755 iron ion transmembrane transport
• GO:0055085 transmembrane transport
• GO:0070574 cadmium ion transmembrane transport
• GO:0071577 zinc ion transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:2qfi, PDBe:2qfi, PDBj:2qfi
• PDBsum: 2qfi
• PubMed: 17717154
• UniProt: P69380|FIEF_ECOLI Cation-efflux pump FieF (Gene Name=fieF)