Structure of PDB 2q5b Chain B |
>2q5bB (length=105) Species: 32059 (Phormidium laminosum) [Search protein sequence] |
ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPG ASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGK ITVEG |
|
PDB | 2q5b Plastocyanin at high resolution from Phormidium laminosum and the double mutant D44A, D45A |
Chain | B |
Resolution | 1.45 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H39 C89 H92 M97 |
H39 C89 H92 M97 |
|
|
|
|