Structure of PDB 2q2l Chain B |
>2q2lB (length=152) Species: 487759 (Potentilla atrosanguinea) [Search protein sequence] |
MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALG DTTNGCMSTGPHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVD KQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGL QG |
|
PDB | 2q2l SAD phasing of a structure based on cocrystallized iodides using an in-house Cu Kalpha X-ray source: effects of data redundancy and completeness on structure solution |
Chain | B |
Resolution | 2.367 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H62 H70 H79 D82 |
H62 H70 H79 D82 |
|
|
|
|