Structure of PDB 2q16 Chain B

Receptor sequence

>2q16B (length=193) Species: 83333 (Escherichia coli K-12)

KVVLATGNVGKVRELASLLSDFGLDIVAQTDLGVDSAEETGLTFIENAIL
KARHAAKVTALPAIADASGLAVDVLGGAPGIYSARYSGEDATDQKNLQKL
LETMKDVPDDQRQARFHCVLVYLRHAEDPTPLVCHGSWPGVITREPAGTG
GFGYDPIFFVPSEGKTAAELTREEKSAISHRGQALKLLLDALR

3D structure

• PDB: 2q16 Molecular basis of the antimutagenic activity of the house-cleaning inosine triphosphate pyrophosphatase RdgB from Escherichia coli.
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.66: XTP/dITP diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ITT	B	T8 N10 K13 E41 K53 S70 S85 A86 F118 F154 G155 Y156 D157 K177 H182 R183	T6 N8 K11 E39 K51 S68 S83 A84 F116 F152 G153 Y154 D155 K175 H180 R181

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0016787 hydrolase activity
• GO:0017111 ribonucleoside triphosphate phosphatase activity
• GO:0035870 dITP diphosphatase activity
• GO:0036220 ITP diphosphatase activity
• GO:0036222 XTP diphosphatase activity
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding
• GO:0047429 nucleoside triphosphate diphosphatase activity

Biological Process

• GO:0009117 nucleotide metabolic process
• GO:0009143 nucleoside triphosphate catabolic process
• GO:0009146 purine nucleoside triphosphate catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2q16, PDBe:2q16, PDBj:2q16
• PDBsum: 2q16
• PubMed: 17976651
• UniProt: P52061|IXTPA_ECOLI dITP/XTP pyrophosphatase (Gene Name=rdgB)