Structure of PDB 2pyo Chain B

Receptor sequence
>2pyoB (length=80) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY
TEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB2pyo Structure of the Drosophila nucleosome core particle highlights evolutionary constraints on the H2A-H2B histone dimer.
ChainB
Resolution2.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B T30 P32 R36 R45 T8 P10 R14 R23
BS02 dna B R35 R45 I46 S47 G48 R78 K79 T80 R13 R23 I24 S25 G26 R56 K57 T58
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000228 nuclear chromosome
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pyo, PDBe:2pyo, PDBj:2pyo
PDBsum2pyo
PubMed17957772
UniProtP84040|H4_DROME Histone H4 (Gene Name=His4)

[Back to BioLiP]