Structure of PDB 2pyn Chain B |
>2pynB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMSLPGAWKPKMIGGI GGFIKVRQYDQILIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 2pyn Molecular analysis of the HIV-1 resistance development: enzymatic activities, crystal structures, and thermodynamics of nelfinavir-resistant HIV protease mutants |
Chain | B |
Resolution | 1.85 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1UN |
B |
D25 G27 G49 I50 |
D25 G27 G49 I50 |
PDBbind-CN: -logKd/Ki=7.57,Kd=27nM |
|
|
|