Structure of PDB 2pks Chain B

Receptor sequence
>2pksB (length=147) Species: 9606 (Homo sapiens) [Search protein sequence]
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET
3D structure
PDB2pks Design, synthesis and biological evaluation of thrombin inhibitors based on a pyridine scaffold.
ChainB
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H79 D135
Catalytic site (residue number reindexed from 1) H43 D99
Enzyme Commision number 3.4.21.5: thrombin.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B E44 I45 G46 M47 P49 W50 D149 H152 P153 V154 C155 L165 Y170 K171 R173 E8 I9 G10 M11 P13 W14 D113 H116 P117 V118 C119 L129 Y134 K135 R137
BS02 peptide B L62 R98 R104 T105 R106 Y107 K113 I114 L26 R62 R68 T69 R70 Y71 K77 I78
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2pks, PDBe:2pks, PDBj:2pks
PDBsum2pks
PubMed18019535
UniProtP00734|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]