Structure of PDB 2pjt Chain B

Receptor sequence
>2pjtB (length=164) Species: 9606 (Homo sapiens) [Search protein sequence]
YNVFPTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT
RLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDD
ETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFML
PDDDVQGIQSLYGP
3D structure
PDB2pjt Structure-based design of TACE selective inhibitors: manipulations in the S1'-S3' pocket.
ChainB
Resolution2.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H197 E198 H201 H207
Catalytic site (residue number reindexed from 1) H118 E119 H122 H128
Enzyme Commision number 3.4.24.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B H197 H201 H207 H118 H122 H128
BS02 ZN B H147 D149 H162 H175 H68 D70 H83 H96
BS03 CA B D154 G155 S157 L159 D177 E180 D75 G76 S78 L80 D98 E101
BS04 CA B D137 N169 Y170 G171 D173 D58 N90 Y91 G92 D94
BS05 347 B L160 A161 L193 V194 H197 E198 H201 H207 L214 P217 Y219 L81 A82 L114 V115 H118 E119 H122 H128 L135 P138 Y140 BindingDB: IC50=860nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2pjt, PDBe:2pjt, PDBj:2pjt
PDBsum2pjt
PubMed17606376
UniProtP45452|MMP13_HUMAN Collagenase 3 (Gene Name=MMP13)

[Back to BioLiP]