Structure of PDB 2peg Chain B

Receptor sequence

>2pegB (length=141) Species: 40690 (Trematomus bernacchii)

VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGNAEAII
GNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDPDNFKL
LSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH

3D structure

• PDB: 2peg Structural characterization of ferric hemoglobins from three antarctic fish species of the suborder notothenioidei.
• Chain: B
• Resolution: 1.48 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	H41 F42 H63 K66 V67 L91 H92 L96 F103 L106 L141	H41 F42 H58 K61 V62 L86 H87 L91 F98 L101 L136

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:2peg, PDBe:2peg, PDBj:2peg
• PDBsum: 2peg
• PubMed: 17545238
• UniProt: P80044|HBB_TREBE Hemoglobin subunit beta (Gene Name=hbb)