Structure of PDB 2p9s Chain B

Receptor sequence
>2p9sB (length=197) Species: 9913 (Bos taurus) [Search protein sequence]
TGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGY
AFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRII
KVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIV
LSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPR
3D structure
PDB2p9s Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
ChainB
Resolution2.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP B G160 D161 G162 G186 R214 K217 E218 G306 S307 M309 Y310 G8 D9 G10 G34 R62 K65 E66 G154 S155 M157 Y158
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0051015 actin filament binding
Biological Process
GO:0010592 positive regulation of lamellipodium assembly
GO:0034314 Arp2/3 complex-mediated actin nucleation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2001032 regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005885 Arp2/3 protein complex
GO:0005938 cell cortex
GO:0035861 site of double-strand break
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2p9s, PDBe:2p9s, PDBj:2p9s
PDBsum2p9s
PubMed17499050
UniProtA7MB62|ARP2_BOVIN Actin-related protein 2 (Gene Name=ACTR2)

[Back to BioLiP]