Structure of PDB 2p3d Chain B |
>2p3dB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPIVTIKVEGQLREALLDTGADDTVLEDINLSGKWKPKIIGGI RGFVKVKQYEDILIEICGHRAVGAVLVGPTPANIIGRNMLTQIGCTLNF |
|
PDB | 2p3d Structural Characterization of B and non-B Subtypes of HIV-Protease: Insights into the Natural Susceptibility to Drug Resistance Development. |
Chain | B |
Resolution | 2.8 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
3.4.23.16: HIV-1 retropepsin. |
|
|
|
|