Structure of PDB 2p06 Chain B |
>2p06B (length=88) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence] |
LYFQGMDYFRLAEKFLREMHAKYMKRVSRPGNTPRPWFDFSEERLLSRLF EEMDELREAVEKEDWENLRDELLDVANFCMYLWGKLSV |
|
PDB | 2p06 Crystal structure of a predicted coding region AF_0060 from Archaeoglobus fulgidus DSM 4304 |
Chain | B |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
E47 E50 E66 D69 |
E52 E55 E71 D74 |
|
|
|