Structure of PDB 2os8 Chain B |
>2os8B (length=135) Species: 6577 (Placopecten magellanicus) [Search protein sequence] |
IQEMKEAFTMIDQNRDGFIDINDLKEMFSSLGRTPDDKELTAMLKEAPGP LNFTMFLSIFSDKLSGTDSEETIRNAFGMFDELDTKKLNIEYIKDLLENM GDNFNKDEMRMTFKEAPVEGGKFDYVRFVAMIKGS |
|
PDB | 2os8 Rigor-like Structures from Muscle Myosins Reveal Key Mechanical Elements in the Transduction Pathways of This Allosteric Motor. |
Chain | B |
Resolution | 3.27 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D28 F34 I35 D39 |
D12 F18 I19 D23 |
|
|
|
|