Structure of PDB 2omt Chain B |
>2omtB (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] |
GPLGSWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTP PVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILI TVTD |
|
PDB | 2omt Thermodynamically reengineering the listerial invasion complex InlA/E-cadherin. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
E11 D100 |
E15 D104 |
|
|
|
|