Structure of PDB 2ol3 Chain B

Receptor sequence

>2ol3B (length=113) Species: 10090 (Mus musculus)

VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTL
RSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSADRVGN
TLYFGEGSRLIVV

3D structure

• PDB: 2ol3 How much can a T-cell antigen receptor adapt to structurally distinct antigenic peptides?
• Chain: B
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D97 R98 V99	D96 R97 V98

Gene Ontology

Molecular Function

• GO:0042605 peptide antigen binding

Biological Process

• GO:0002250 adaptive immune response

Cellular Component

• GO:0042101 T cell receptor complex

External links

• PDB: RCSB:2ol3, PDBe:2ol3, PDBj:2ol3
• PDBsum: 2ol3
• PubMed: 17363906
• UniProt: P04214|TVB6_MOUSE T-cell receptor beta chain V region E1