Structure of PDB 2og0 Chain B

Receptor sequence

>2og0B (length=52) Species: 10710 (Lambdavirus lambda)

MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKV
DL

3D structure

• PDB: 2og0 Fis targets assembly of the xis nucleoprotein filament to promote excisive recombination by phage lambda.
• Chain: B
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	R16 S17 E19 T20 R23 G38 R39	R16 S17 E19 T20 R23 G38 R39
BS02	dna	B	E19 R22 R26 K36 R39 E40 Y41	E19 R22 R26 K36 R39 E40 Y41

Gene Ontology

Molecular Function

• GO:0003677 DNA binding

Biological Process

• GO:0006310 DNA recombination

External links

• PDB: RCSB:2og0, PDBe:2og0, PDBj:2og0
• PDBsum: 2og0
• PubMed: 17275024
• UniProt: P03699|VXIS_LAMBD Excisionase (Gene Name=xis)