Structure of PDB 2odi Chain B

Receptor sequence

>2odiB (length=238) Species: 54910 (Brevibacillus centrosporus)

MKIWSKEEVVNKLHEIKNKGYLSVPTDMFRTDDGVVGQILERQFGVQENN
ITLGDLGEFELKGMRNRKAKSNLTLFHKKPVAGQTVIQIFNRFGYVKPSS
RNPEVMKKKLFTTIKGGRLNNLGLTLNAKHASEINLYYQDEYLSTWDLNL
SKIEKLVLVFAETIGRANSPEEQFHFTKAYMLTEINDITSLINDGVLVMD
LCIDQDLSKSKGPHDRGPHLRIPISKLDKLYRNIERLL

3D structure

• PDB: 2odi Monomeric restriction endonuclease BcnI in the apo form and in an asymmetric complex with target DNA.
• Chain: B
• Resolution: 1.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	D33 G34 V36 G37 Q38 N49 K62 G63 R65 R67 S71 T74 F76 H77 K78 K79 R216 H219 R221	D33 G34 V36 G37 Q38 N49 K62 G63 R65 R67 S71 T74 F76 H77 K78 K79 R216 H219 R221
BS02	dna	B	R30 D32 Y95 K97 S100 R101 K109 F111 T113 K115 R118 N120 N121 D200 C202 H214 R216	R30 D32 Y95 K97 S100 R101 K109 F111 T113 K115 R118 N120 N121 D200 C202 H214 R216
BS03	CA	B	D55 E60 L61	D55 E60 L61

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

External links

• PDB: RCSB:2odi, PDBe:2odi, PDBj:2odi
• PDBsum: 2odi
• PubMed: 17445830
• UniProt: Q8RNV8