Structure of PDB 2od3 Chain B

Receptor sequence

>2od3B (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGFKVNDTKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFYTHVFRLKKWIQKVIDQ

3D structure

• PDB: 2od3 Structural basis of na+ activation mimicry in murine thrombin.
• Chain: B
• Resolution: 1.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 E192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H43 D99 E195 G196 D197 S198 G199
• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D21 E23 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 K186D K202 N205 R206 W207	D6 E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N157 K189 K205 N210 R211 W212
BS02	0G6	B	H57 W60D N98 L99 D189 A190 S195 W215 G216	H43 W50 N95 L96 D192 A193 S198 W220 G221

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:2od3, PDBe:2od3, PDBj:2od3
• PDBsum: 2od3
• PubMed: 17428793
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)