Structure of PDB 2ob0 Chain B

Receptor sequence

>2ob0B (length=152) Species: 9606 (Homo sapiens)

SRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFND
IAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKD
GTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKN
LK

3D structure

• PDB: 2ob0 Structure of Human MAK3 homolog
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ACO	B	I26 F27 P28 L77 G78 C79 R84 R85 G87 G89 T90 Q114 N117 S119 A120 D122 F123 K126 Y139	I23 F24 P25 L74 G75 C76 R81 R82 G84 G86 T87 Q111 N114 S116 A117 D119 F120 K123 Y136	BindingDB: Kd=18nM

Gene Ontology

Molecular Function

• GO:0004596 peptide alpha-N-acetyltransferase activity
• GO:0005515 protein binding
• GO:0010485 histone H4 acetyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0061733 peptide-lysine-N-acetyltransferase activity
• GO:0120518 peptide-methionine-alpha-N-acetyltransferase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006474 N-terminal protein amino acid acetylation
• GO:0007064 mitotic sister chromatid cohesion
• GO:0034087 establishment of mitotic sister chromatid cohesion
• GO:0071962 mitotic sister chromatid cohesion, centromeric

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031415 NatA complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:2ob0, PDBe:2ob0, PDBj:2ob0
• PDBsum: 2ob0
• UniProt: Q9GZZ1|NAA50_HUMAN N-alpha-acetyltransferase 50 (Gene Name=NAA50)