Structure of PDB 2n82 Chain B

Receptor sequence

>2n82B (length=104) Species: 9606 (Homo sapiens)

GSHMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERG
SKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNP
YTNG

3D structure

• PDB: 2n82 Rbfox proteins regulate microRNA biogenesis by sequence-specific binding to their precursors and target downstream Dicer.
• Chain: B
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	R118 H120 S122 N123 I124 P125 F126 I149 F150 N151 E152 R153 G154 S155 K156 G157 F158 F160 R184 N189 N190 A191 T192 A193 R194 V195 N198 K199 K200 N203 Y205 T206	R14 H16 S18 N19 I20 P21 F22 I45 F46 N47 E48 R49 G50 S51 K52 G53 F54 F56 R80 N85 N86 A87 T88 A89 R90 V91 N94 K95 K96 N99 Y101 T102	PDBbind-CN: Kd=21.5nM

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding

Biological Process

• GO:0000381 regulation of alternative mRNA splicing, via spliceosome
• GO:0007399 nervous system development

External links

• PDB: RCSB:2n82, PDBe:2n82, PDBj:2n82
• PDBsum: 2n82
• PubMed: 27001519
• UniProt: Q9NWB1|RFOX1_HUMAN RNA binding protein fox-1 homolog 1 (Gene Name=RBFOX1)