Structure of PDB 2msr Chain B |
>2msrB (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] |
SNAASRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQ QAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNM |
|
PDB | 2msr Validation and Structural Characterization of the LEDGF/p75-MLL Interface as a New Target for the Treatment of MLL-Dependent Leukemia. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
L363 F406 V408 |
L25 F68 V70 |
|
|
|