Structure of PDB 2mpg Chain B

Receptor sequence

>2mpgB (length=30) Species: 9606 (Homo sapiens)

FVNQHLCASHLVEALYLVCGERGFFYTKPT

3D structure

• PDB: 2mpg Insight into the structural and biological relevance of the T/R transition of the N-terminus of the B-chain in human insulin.
• Chain: B
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	F1 N3 Q4 H5 L6 C7 L11 C19 Y26	F1 N3 Q4 H5 L6 C7 L11 C19 Y26

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:2mpg, PDBe:2mpg, PDBj:2mpg
• PDBsum: 2mpg
• PubMed: 24819248
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)