Structure of PDB 2mp0 Chain B

Receptor sequence
>2mp0B (length=149) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMVAPVDGTIG
KIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDT
VIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETPVIRIK
3D structure
PDB2mp0 Visualizing an ultra-weak protein-protein interaction in phosphorylation signaling.
ChainB
ResolutionN/A
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T373 H375 H390
Catalytic site (residue number reindexed from 1) T55 H57 H72
Enzyme Commision number 2.7.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PO3 B F371 H375 F53 H57
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0016301 kinase activity
GO:0046872 metal ion binding
Biological Process
GO:0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 phosphorylation
GO:0034763 negative regulation of transmembrane transport
GO:0043610 regulation of carbohydrate utilization
GO:0045912 negative regulation of carbohydrate metabolic process
GO:1902344 negative regulation of maltose transport
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009898 cytoplasmic side of plasma membrane
GO:0016020 membrane
GO:1902495 transmembrane transporter complex
GO:1990154 enzyme IIA-maltose transporter complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2mp0, PDBe:2mp0, PDBj:2mp0
PDBsum2mp0
PubMed25131700
UniProtP69783|PTGA_ECOLI PTS system glucose-specific EIIA component (Gene Name=crr)

[Back to BioLiP]