Structure of PDB 2mf0 Chain B

Receptor sequence

>2mf0B (length=59) Species: 220664 (Pseudomonas protegens Pf-5)

MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQR
IQAGLTAPD

3D structure

• PDB: 2mf0 Structural basis of the non-coding RNA RsmZ acting as a protein sponge.
• Chain: B
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	M1 L2 I3 L4 T5 K7 L23 Q28 Q29 R31 A36 P37 K38 V42 H43 R44 I47 R50 I51 A57 P58	M1 L2 I3 L4 T5 K7 L23 Q28 Q29 R31 A36 P37 K38 V42 H43 R44 I47 R50 I51 A57 P58

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0048027 mRNA 5'-UTR binding

Biological Process

• GO:0006109 regulation of carbohydrate metabolic process
• GO:0006402 mRNA catabolic process
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation
• GO:0045948 positive regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2mf0, PDBe:2mf0, PDBj:2mf0
• PDBsum: 2mf0
• PubMed: 24828038
• UniProt: P0DPC3|CSRA1_PSEPH Translational regulator CsrA1 (Gene Name=csrA1)