Structure of PDB 2ljy Chain B |
>2ljyB (length=70) Species: 333760 (Human papillomavirus 16) [Search protein sequence] |
MFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDL CIVYRDGNPYAVCDKCLKFY |
|
PDB | 2ljy Solution Structure Analysis of the HPV16 E6 Oncoprotein Reveals a Self-Association Mechanism Required for E6-Mediated Degradation of p53. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C30 C33 |
C30 C33 |
|
|
|