Structure of PDB 2leg Chain B

Receptor sequence
>2legB (length=134) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AWLLMAFTALALELTALWFQHVMLLKPCVLCIYERVALFGVLGAALIGAI
APKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEW
LPLDKWVPQVFVAMPQWLLGIFIAYLIVAVLVVI
3D structure
PDB2leg High-resolution membrane protein structure by joint calculations with solid-state NMR and X-ray experimental data.
ChainB
ResolutionN/A
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C41 C44 R48 C104
Catalytic site (residue number reindexed from 1) C28 C31 R35 C91
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 UQ1 B F32 K39 L43 C44 P143 L146 F19 K26 L30 C31 P115 L118
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0015035 protein-disulfide reductase activity
GO:0016491 oxidoreductase activity
GO:0016672 oxidoreductase activity, acting on a sulfur group of donors, quinone or similar compound as acceptor
GO:0048039 ubiquinone binding
Biological Process
GO:0006457 protein folding
GO:0009408 response to heat
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2leg, PDBe:2leg, PDBj:2leg
PDBsum2leg
PubMed21938394
UniProtP0A6M2|DSBB_ECOLI Disulfide bond formation protein B (Gene Name=dsbB)

[Back to BioLiP]