Structure of PDB 2k7o Chain B

Receptor sequence
>2k7oB (length=91) Species: 10116 (Rattus norvegicus) [Search protein sequence]
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ
EVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE
3D structure
PDB2k7o Refinement of the solution structure and dynamic properties of Ca(2+)-bound rat S100B.
ChainB
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA B S18 E21 K26 E31 S18 E21 K26 E31
BS02 CA B D61 D63 D65 E67 E72 D61 D63 D65 E67 E72
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044548 S100 protein binding
GO:0046872 metal ion binding
GO:0048156 tau protein binding
GO:0048306 calcium-dependent protein binding
GO:0050786 RAGE receptor binding
Biological Process
GO:0007155 cell adhesion
GO:0007611 learning or memory
GO:0007613 memory
GO:0008284 positive regulation of cell population proliferation
GO:0008360 regulation of cell shape
GO:0031643 positive regulation of myelination
GO:0043065 positive regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045666 positive regulation of neuron differentiation
GO:0048168 regulation of neuronal synaptic plasticity
GO:0048708 astrocyte differentiation
GO:0050806 positive regulation of synaptic transmission
GO:0051384 response to glucocorticoid
GO:0051597 response to methylmercury
GO:0060291 long-term synaptic potentiation
GO:0071456 cellular response to hypoxia
GO:0097490 sympathetic neuron projection extension
GO:1990138 neuron projection extension
GO:1990845 adaptive thermogenesis
GO:2001015 negative regulation of skeletal muscle cell differentiation
Cellular Component
GO:0001726 ruffle
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0043025 neuronal cell body
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2k7o, PDBe:2k7o, PDBj:2k7o
PDBsum2k7o
PubMed18949447
UniProtP04631|S100B_RAT Protein S100-B (Gene Name=S100b)

[Back to BioLiP]