Structure of PDB 2jti Chain B

Receptor sequence

>2jtiB (length=103) Species: 4932 (Saccharomyces cerevisiae)

GSAKKGATLFKARCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTD
ANIKKNVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKK
ACE

3D structure

• PDB: 2jti Shifting the equilibrium between the encounter state and the specific form of a protein complex by interfacial point mutations.
• Chain: B
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	B	C14 C17 H18 G29 P30 S40 Y48 T49 N52 W59 K79 M80 F82	C14 C17 H18 G29 P30 S40 Y48 T49 N52 W59 K79 M80 F82

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:2jti, PDBe:2jti, PDBj:2jti
• PDBsum: 2jti
• PubMed: 20672804
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)