Structure of PDB 2jg8 Chain B |
>2jg8B (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] |
ATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGL YYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLE QGENVFLQATDKNSLLGMEGANSIFSGFLLFPD |
|
PDB | 2jg8 C1Q Binds Phosphatidylserine and Likely Acts as a Multiligand-Bridging Molecule in Apoptotic Cell Recognition. |
Chain | B |
Resolution | 2.05 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
D172 Y173 Q179 |
D82 Y83 Q89 |
|
|
|