Structure of PDB 2j0t Chain B

Receptor sequence
>2j0tB (length=162) Species: 9606 (Homo sapiens) [Search protein sequence]
GNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSE
GQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWT
NNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDID
GIQAIYGRSQNP
3D structure
PDB2j0t Crystal Structure of the Catalytic Domain of Matrix Metalloproteinase-1 in Complex with the Inhibitory Domain of Tissue Inhibitor of Metalloproteinase-1.
ChainB
Resolution2.54 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H218 E219 H222 H228
Catalytic site (residue number reindexed from 1) H114 E115 H118 H124
Enzyme Commision number 3.4.24.7: interstitial collagenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B H168 D170 H183 H196 H64 D66 H79 H92
BS02 ZN B H218 H222 H228 H114 H118 H124
BS03 CA B D158 G190 G192 D194 D54 G86 G88 D90
BS04 CA B D175 G176 G178 N180 D198 E201 D71 G72 G74 N76 D94 E97
BS05 CA B D124 E199 E201 D20 E95 E97
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2j0t, PDBe:2j0t, PDBj:2j0t
PDBsum2j0t
PubMed17050530
UniProtP03956|MMP1_HUMAN Interstitial collagenase (Gene Name=MMP1)

[Back to BioLiP]