Structure of PDB 2iyn Chain B |
>2iynB (length=124) Species: 562 (Escherichia coli) [Search protein sequence] |
MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLI LLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGAD DYITKPFSPKELVARIKAVMRRIS |
|
PDB | 2iyn The Cofactor-Induced Pre-Active Conformation in Phob. |
Chain | B |
Resolution | 2.08 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D10 D53 |
D10 D53 |
|
|
|
|