Structure of PDB 2ivf Chain B

Receptor sequence

>2ivfB (length=337) Species: 76114 (Aromatoleum aromaticum EbN1)

KRQLVTVIDLNKCLGCQTCTVACKNIWTKRPGTEHMRWNNVTTYPGKGYP
RDYERKGGGFLRGEPQPGVLPTLIDSGDDFQFNHKEVFYEGKGQTVHFHP
TSKSTGKDPAWGYNWDEDQGGGKWPNPFFFYLARMCNHCTNPACLAACPT
GAIYKREDNGIVLVDQERCKGHRHCVEACPYKAIYFNPVSQTSEKCILCY
PRIEKGIANACNRQCPGRVRAFGYLDDTTSHVHKLVKKWKVALPLHAEYG
TGPNIYYVPPMGARGFGEDGEITDKTRIPLDVLEGLFGPEVKRVLAVLHT
ERENMRAGRGSELMDLLISKKWSDRFGGFTNDPLTQS

3D structure

• PDB: 2ivf Crystal Structure of Ethylbenzene Dehydrogenase from Aromatoleum Aromaticum
• Chain: B
• Resolution: 1.88 Å

Enzymatic activity

• Enzyme Commision number: 1.17.99.2: ethylbenzene hydroxylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F3S	B	C163 T165 I168 C184 K185 G186 H187 R188 H189 C190 S208	C148 T150 I153 C169 K170 G171 H172 R173 H174 C175 S193
BS02	SF4	B	C151 N152 H153 C154 P157 C159 V177 C194 A198 I199 K210	C136 N137 H138 C139 P142 C144 V162 C179 A183 I184 K195
BS03	SF4	B	C28 L29 G30 C31 Q32 C34 V56 C230 V234 R235	C13 L14 G15 C16 Q17 C19 V41 C215 V219 R220
BS04	SF4	B	C38 W42 W53 N54 M150 C211 I212 L213 C214 N224 C226	C23 W27 W38 N39 M135 C196 I197 L198 C199 N209 C211
BS05	HEM	B	T165 K185 H187	T150 K170 H172

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0016020 membrane
• GO:0042597 periplasmic space

External links

• PDB: RCSB:2ivf, PDBe:2ivf, PDBj:2ivf
• PDBsum: 2ivf
• PubMed: 16962969
• UniProt: Q5P5I1