Structure of PDB 2ipf Chain B

Receptor sequence

>2ipfB (length=318) Species: 10090 (Mus musculus) [Search protein sequence]

HCVILNDGNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVY
NTEDHVGEAIRSKIADGTVRREDIFYTSKVWCTSLHPELVRASLERSLQK
LQFDYVDLYLIHYPMALKPGEENFPVDEHGKLIFDRVDLCATWEAMEKCK
DAGLTKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHPYLNQMKLLDF
CKSKDIVLVAYGVLGTQRYGGWVDQNSPVLLDEPVLGSMAKKYNRTPALI
ALRYQLQRGIVVLNTSLKEERIKENMQVFEFQLSSEDMKVLDGLNRNMRY
IPAAIFKGHPNWPFLDEY

3D structure

PDB

2ipf Mouse 17alpha-Hydroxysteroid Dehydrogenase (AKR1C21) Binds Steroids Differently from other Aldo-keto Reductases: Identification and Characterization of Amino Acid Residues Critical for Substrate Binding.

Chain

Resolution

1.85 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D50 Y55 K84 H117
Catalytic site (residue number reindexed from 1)	D45 Y50 K79 H112
Enzyme Commision number	1.1.1.- 1.1.1.209: 3(or 17)alpha-hydroxysteroid dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	G22 A24 D50 Y55 H117 Q190 Y216 G217 L219 T221 Q222 Y224 L236 A253 T270 S271 L272 K273 R276 E279 N280	G17 A19 D45 Y50 H112 Q185 Y211 G212 L214 T216 Q217 Y219 L231 A248 T265 S266 L267 K268 R271 E274 N275
BS02	FFA	B	L25 K31 Y55 H117 F129 Y224 W227	L20 K26 Y50 H112 F124 Y219 W222

Gene Ontology

	Molecular Function
GO:0004033	aldo-keto reductase (NADPH) activity
GO:0005496	steroid binding
GO:0016491	oxidoreductase activity
GO:0033764	steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0047023	androsterone dehydrogenase activity
GO:0047024	5alpha-androstane-3beta,17beta-diol dehydrogenase activity
GO:0070401	NADP+ binding
GO:0070402	NADPH binding
GO:0072555	17-beta-ketosteroid reductase (NADPH) activity
GO:0072582	17-beta-hydroxysteroid dehydrogenase (NADP+) activity
GO:1902121	lithocholic acid binding

	Biological Process
GO:0006694	steroid biosynthetic process
GO:0008202	steroid metabolic process

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2ipf, PDBe:2ipf, PDBj:2ipf
PDBsum	2ipf
PubMed	17442338
UniProt	Q91WR5\|AK1CL_MOUSE Aldo-keto reductase family 1 member C21 (Gene Name=Akr1c21)

[Back to BioLiP]