Structure of PDB 2imz Chain B |
>2imzB (length=141) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] |
CLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFD QGTRDVIGLRIAGGAILWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFD GFEELRYSVIREVLPTRRARTFDLEVEELHTLVAEGVVVHN |
|
PDB | 2imz Crystallographic and mutational studies of Mycobacterium tuberculosis recA mini-inteins suggest a pivotal role for a highly conserved aspartate residue. |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
E424 H429 X440 |
E125 H130 X141 |
|
|
|
|