Structure of PDB 2iez Chain B

Receptor sequence
>2iezB (length=171) Species: 10090 (Mus musculus) [Search protein sequence]
DGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVV
HLQLWDTAGLERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQ
ANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQ
NVEKSVETLLDLIMKRMEKCV
3D structure
PDB2iez Structure of the small GTPase Rab27b shows an unexpected swapped dimer
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP B S18 G19 V20 G21 K22 T23 T24 K134 D136 S163 A164 A165 S16 G17 V18 G19 K20 T21 T22 K116 D118 S145 A146 A147
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0019904 protein domain specific binding
GO:0031489 myosin V binding
Biological Process
GO:0017157 regulation of exocytosis
GO:0045921 positive regulation of exocytosis
GO:0048488 synaptic vesicle endocytosis
GO:0071985 multivesicular body sorting pathway
GO:0099641 anterograde axonal protein transport
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005770 late endosome
GO:0005794 Golgi apparatus
GO:0005795 Golgi stack
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0016324 apical plasma membrane
GO:0030140 trans-Golgi network transport vesicle
GO:0030672 synaptic vesicle membrane
GO:0032585 multivesicular body membrane
GO:0042470 melanosome
GO:0042589 zymogen granule membrane
GO:0043231 intracellular membrane-bounded organelle
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2iez, PDBe:2iez, PDBj:2iez
PDBsum2iez
PubMed17582168
UniProtQ99P58|RB27B_MOUSE Ras-related protein Rab-27B (Gene Name=Rab27b)

[Back to BioLiP]