Structure of PDB 2i89 Chain B

Receptor sequence
>2i89B (length=90) Species: 10116 (Rattus norvegicus) [Search protein sequence]
QGSDPAVTYYRLEEVAKHNTSESTWMVLHGRVYDLTRFLSEHPGGEEVLR
EQAGADATESFEDVGHSPDAREMSKQYYIGDVHPNDLKPK
3D structure
PDB2i89 A histidine/tryptophan pi-stacking interaction stabilizes the heme-independent folding core of microsomal apocytochrome b5 relative to that of mitochondrial apocytochrome b5.
ChainB
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H39 G62
Catalytic site (residue number reindexed from 1) H42 G65
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B M23 F35 H39 P40 G41 L46 A54 F58 V61 H63 S64 A67 M70 S71 M26 F38 H42 P43 G44 L49 A57 F61 V64 H66 S67 A70 M73 S74
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2i89, PDBe:2i89, PDBj:2i89
PDBsum2i89
PubMed17105194
UniProtP04166|CYB5B_RAT Cytochrome b5 type B (Gene Name=Cyb5b)

[Back to BioLiP]