Structure of PDB 2i6u Chain B

Receptor sequence

>2i6uB (length=307) Species: 1773 (Mycobacterium tuberculosis)

VIRHFLRDDDLSPAEQAEVLELAAELKKDPVSRRPLQGPRGVAVIFDKNS
TRTRFSFELGIAQLGGHAVVVDSGSTQLGRDETLQDTAKVLSRYVDAIVW
RTFGQERLDAMASVATVPVINALSDEFHPCQVLADLQTIAERKGALRGLR
LSYFGDGANNMAHSLLLGGVTAGIHVTVAAPEGFLPDPSVRAAAERRAQD
TGASVTVTADAHAAAAGADVLVTDTWTSMGQENDGLDRVKPFRPFQLNSR
LLALADSDAIVLHCLPAHRGDEITDAVMDGPASAVWDEAENRLHAQKALL
VWLLERS

3D structure

• PDB: 2i6u The crystal structures of ornithine carbamoyltransferase from Mycobacterium tuberculosis and its ternary complex with carbamoyl phosphate and L-norvaline reveal the enzyme's catalytic mechanism
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R52 T53 R80 R101 H128 Q131 D224 C264 R292
• Catalytic site (residue number reindexed from 1): R52 T53 R80 R101 H128 Q131 D224 C264 R292
• Enzyme Commision number: 2.1.3.3: ornithine carbamoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CP	B	S50 T51 R52 T53 R101 H128 L265 R292	S50 T51 R52 T53 R101 H128 L265 R292
BS02	NVA	B	L123 N160 D224 S228 M229	L123 N160 D224 S228 M229

Gene Ontology

Molecular Function

• GO:0004585 ornithine carbamoyltransferase activity
• GO:0016597 amino acid binding
• GO:0016740 transferase activity
• GO:0016743 carboxyl- or carbamoyltransferase activity

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0006526 L-arginine biosynthetic process
• GO:0006591 ornithine metabolic process
• GO:0019240 citrulline biosynthetic process
• GO:0042450 arginine biosynthetic process via ornithine

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2i6u, PDBe:2i6u, PDBj:2i6u
• PDBsum: 2i6u
• PubMed: 18062991
• UniProt: P9WIT9|OTC_MYCTU Ornithine carbamoyltransferase (Gene Name=argF)