Structure of PDB 2i5r Chain B |
>2i5rB (length=118) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] |
RRVEKVIIVEGRSDKQKVAAVLNEPVVIVCTNGTISDARLEELADELEGY DVYLLADADEAGEKLRRQFRRMFPEAEHLYIDRAYREVAAAPIWHLAQVL LRARFDVRIESLMRGRGE |
|
PDB | 2i5r Crystal structure and putative function of small Toprim domain-containing protein from Bacillus stearothermophilus. |
Chain | B |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D58 D60 |
D57 D59 |
|
|
|
|