Structure of PDB 2i3p Chain B

Receptor sequence

>2i3pB (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

NTKYNKEFLLYLAGFVDGDGSIIAQIRPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD

3D structure

PDB

2i3p Homing endonuclease I-CreI derivatives with novel DNA target specificities.

Chain

Resolution

2.3 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G319 D320
Catalytic site (residue number reindexed from 1)	G18 D19
Enzyme Commision number	3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S332 Y333 K334 Q338 R368 R370 E380 I381 K416 K439 T440	S31 Y32 K33 Q37 R67 R69 E79 I80 K115 K138 T139
BS02	dna	B	G319 D320 G321 S322 I324 Q326 R328 N330 Q344 T346 Q347 K348 R370 N436 D437 S438 R441 K442	G18 D19 G20 S21 I23 Q25 R27 N29 Q43 T45 Q46 K47 R69 N135 D136 S137 R140 K141

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006314	intron homing

	Cellular Component
GO:0009507	chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2i3p, PDBe:2i3p, PDBj:2i3p
PDBsum	2i3p
PubMed	16971456
UniProt	P05725\|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]