Structure of PDB 2ht0 Chain B

Receptor sequence
>2ht0B (length=93) Species: 562 (Escherichia coli) [Search protein sequence]
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGS
FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIY
3D structure
PDB2ht0 Structure-based Analysis of HU-DNA Binding.
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R46 G47 S50 K81 K84 R46 G47 S50 K81 K84 PDBbind-CN: Kd=0.5nM
BS02 dna B S4 K27 R62 N63 P64 L72 K75 S4 K27 R62 N63 P64 L72 K75 PDBbind-CN: Kd=0.5nM
BS03 dna B E44 I45 R46 H54 R56 H79 E44 I45 R46 H54 R56 H79 PDBbind-CN: Kd=0.5nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0006310 DNA recombination
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
Cellular Component
GO:0005694 chromosome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ht0, PDBe:2ht0, PDBj:2ht0
PDBsum2ht0
PubMed17097674
UniProtQ14F22

[Back to BioLiP]