Structure of PDB 2hka Chain B

Receptor sequence
>2hkaB (length=130) Species: 9913 (Bos taurus) [Search protein sequence]
EPVKFKDCGSWVGVIKEVNVSPCPTQPCKLHRGQSYSVNVTFTSNTQSQS
SKAVVHGIVMGIPVPFPIPESDGCKSGIRCPIEKDKTYNYVNKLPVKNEY
PSIKVVVEWELTDDKNQRFFCWQIPIEVEA
3D structure
PDB2hka Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
ChainB
Resolution1.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 B E1 N19 E1 N19
BS02 C3S B L30 V59 F66 Y100 L30 V59 F66 Y100
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015485 cholesterol binding
GO:0019899 enzyme binding
GO:0032934 sterol binding
GO:0120020 cholesterol transfer activity
Biological Process
GO:0006869 lipid transport
GO:0008203 cholesterol metabolic process
GO:0009615 response to virus
GO:0010467 gene expression
GO:0010878 cholesterol storage
GO:0015918 sterol transport
GO:0016125 sterol metabolic process
GO:0030301 cholesterol transport
GO:0032366 intracellular sterol transport
GO:0032367 intracellular cholesterol transport
GO:0033344 cholesterol efflux
GO:0042632 cholesterol homeostasis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005764 lysosome
GO:0005783 endoplasmic reticulum

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hka, PDBe:2hka, PDBj:2hka
PDBsum2hka
PubMed17573352
UniProtP79345|NPC2_BOVIN NPC intracellular cholesterol transporter 2 (Gene Name=NPC2)

[Back to BioLiP]