Structure of PDB 2hho Chain B

Receptor sequence

>2hhoB (length=30) Species: 9606 (Homo sapiens)

FVNQHLCSSDLVEALYLVCGERGFFYTKPT

3D structure

• PDB: 2hho Toward the Active Conformation of Insulin: Stereospecific modulation of a structural switch in the B chain.
• Chain: B
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	Q4 L6 C7 L11 L15 V18 C19 R22 F25 Y26	Q4 L6 C7 L11 L15 V18 C19 R22 F25 Y26

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:2hho, PDBe:2hho, PDBj:2hho
• PDBsum: 2hho
• PubMed: 16762918
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)